PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02463.30
Common NameJCGZ_11632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 300aa    MW: 34531.2 Da    PI: 4.9293
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02463.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.61.6e-25135184352
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    k ++ e +skyF++pi++AAkeL+v+lT+LK++CR++ I+RWPhRk+ sl
  Jcr4S02463.30 135 KALTRERISKYFYMPITQAAKELNVGLTLLKKRCRELDIRRWPHRKLMSL 184
                    789********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.302118205IPR003035RWP-RK domain
PfamPF020421.9E-21137184IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAASTGFSGH NEIVSKEEDL FFATHLQLPS FDFCGNPFSL VVDWHSELSI QESFLDCHPF  60
VSDPLYASLD IGQSEDDING LGVWKELGPL FEPQKQLLLL GDTNSKDSSM GESTEEKRKV  120
KKCREEKVSN NSISKALTRE RISKYFYMPI TQAAKELNVG LTLLKKRCRE LDIRRWPHRK  180
LMSLQTLIEN LQQMKVEGKE SEEKLKEAIE ILEREKRMLE EMPDMDLEHK TKRLRQACFK  240
ANYKKRKLMG SCSSSSSGSL IATTAHDYIT ANDYQEEEED DDEEIKSLLE VPFPYDNLIF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080549.10.0PREDICTED: protein RKD1
TrEMBLA0A067K4X80.0A0A067K4X8_JATCU; Uncharacterized protein
STRINGVIT_17s0000g06250.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-42RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]